Protocadherin 1 Antikörper (N-Term)

Produktnummer ABIN634688

Der Kaninchen Polyklonal Anti-Protocadherin 1-Antikörper wurde für WB validiert. Er ist geeignet, Protocadherin 1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Protocadherin 1 Antikörper (N-Term) (ABIN634688)

Target: Protocadherin 1 (PCDH1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Protocadherin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Protocadherin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PCDH1 antibody was raised against the N terminal of PCDH1

Aufreinigung: Affinity purified

Immunogen: PCDH1 antibody was raised using the N terminal of PCDH1 corresponding to a region with amino acids LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDH1 Blocking Peptide, (ABIN5615240), is also available for use as a blocking control in assays to test for specificity of this PCDH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Protocadherin 1

Target: Protocadherin 1 (PCDH1)

Andere Bezeichnung: PCDH1

Hintergrund: PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.

Molekulargewicht: 111 kDa (MW of target protein)