ROM1 Antikörper (Middle Region)

Produktnummer ABIN634680

Der Kaninchen Polyklonal anti-ROM1 Antikörper (ABIN634680) detektiert spezifisch ROM1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ROM1 Antikörper (Middle Region) (ABIN634680)

Target: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ROM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ROM1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ROM1 antibody was raised against the middle region of ROM1

Aufreinigung: Affinity purified

Immunogen: ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ROM1 Blocking Peptide, (ABIN5615915), is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ROM1

Target: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Andere Bezeichnung: ROM1

Hintergrund: ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.

Molekulargewicht: 37 kDa (MW of target protein)