ADAM15 Antikörper (Middle Region)

Produktnummer ABIN634676

Produktdetails anti-ADAM15 Antikörper

Target: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADAM15 antibody was raised against the middle region of ADAM15

Aufreinigung: Affinity purified

Immunogen: ADAM15 antibody was raised using the middle region of ADAM15 corresponding to a region with amino acids QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM15 Blocking Peptide, catalog no. 33R-7669, is also available for use as a blocking control in assays to test for specificity of this ADAM15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM15

Target: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Andere Bezeichnung: ADAM15 (ADAM15 Produkte)

Synonyme: ADAM15 antikoerper, mdc15 antikoerper, MDC15 antikoerper, metargidin antikoerper, tMDCVI antikoerper, ADAM metallopeptidase domain 15 antikoerper, ADAM metallopeptidase domain 15 L homeolog antikoerper, a disintegrin and metallopeptidase domain 15 (metargidin) antikoerper, ADAM15 antikoerper, adam15.L antikoerper, adam15 antikoerper, Adam15 antikoerper

Hintergrund: ADAM15 is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain.

Molekulargewicht: 70 kDa (MW of target protein)