Claudin 23 Antikörper (C-Term)

Produktnummer ABIN634675

Produktdetails anti-Claudin 23 Antikörper

Target: Claudin 23 (CLDN23)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Claudin 23 antibody was raised against the C terminal of CLDN23

Aufreinigung: Affinity purified

Immunogen: Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE

Anwendungsinformationen

Applikationshinweise: WB: 0.2-0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 23 Blocking Peptide, catalog no. 33R-4034, is also available for use as a blocking control in assays to test for specificity of this Claudin 23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 23

Target: Claudin 23 (CLDN23)

Andere Bezeichnung: Claudin 23 (CLDN23 Produkte)

Synonyme: CLDN23 antikoerper, CLDNL antikoerper, hCG1646163 antikoerper, 2310014B08Rik antikoerper, claudin 23 antikoerper, si:ch211-95j8.2 antikoerper, CLDN23 antikoerper, si:ch211-95j8.2 antikoerper, Cldn23 antikoerper

Hintergrund: CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C