ITGB3BP Antikörper

Produktnummer ABIN634666

Produktdetails anti-ITGB3BP Antikörper

Target: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITGB3BP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ITGB3 BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITGB3BP Blocking Peptide, catalog no. 33R-9096, is also available for use as a blocking control in assays to test for specificity of this ITGB3BP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITGB3BP

Target: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Andere Bezeichnung: ITGB3BP (ITGB3BP Produkte)

Synonyme: CENP-R antikoerper, CENPR antikoerper, HSU37139 antikoerper, NRIF3 antikoerper, TAP20 antikoerper, 4930471O16Rik antikoerper, AU022583 antikoerper, integrin subunit beta 3 binding protein antikoerper, integrin beta 3 binding protein (beta3-endonexin) antikoerper, ITGB3BP antikoerper, Itgb3bp antikoerper

Hintergrund: ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung