AZGP1 Antikörper (N-Term)

Produktnummer ABIN634659

Produktdetails anti-AZGP1 Antikörper

Target: AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AZGP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AZGP1 antibody was raised against the N terminal of AZGP1

Aufreinigung: Affinity purified

Immunogen: AZGP1 antibody was raised using the N terminal of AZGP1 corresponding to a region with amino acids KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AZGP1 Blocking Peptide, catalog no. 33R-4700, is also available for use as a blocking control in assays to test for specificity of this AZGP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AZGP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AZGP1

Target: AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))

Andere Bezeichnung: AZGP1 (AZGP1 Produkte)

Synonyme: Zag antikoerper, ZA2G antikoerper, ZAG antikoerper, ZA2GA antikoerper, Zna2gp antikoerper, alpha-2-glycoprotein 1, zinc antikoerper, alpha-2-glycoprotein 1, zinc-binding antikoerper, Azgp1 antikoerper, AZGP1 antikoerper

Hintergrund: Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process