SIPA1 Antikörper (Middle Region)
-
- Target Alle SIPA1 Antikörper anzeigen
- SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SIPA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SIPA1 antibody was raised against the middle region of SIPA1
- Aufreinigung
- Affinity purified
- Immunogen
- SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS
- Top Product
- Discover our top product SIPA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SIPA1 Blocking Peptide, catalog no. 33R-8976, is also available for use as a blocking control in assays to test for specificity of this SIPA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIPA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))
- Andere Bezeichnung
- SIPA1 (SIPA1 Produkte)
- Synonyme
- Spa1 antikoerper, SPA1 antikoerper, signal-induced proliferation-associated 1 antikoerper, Signal peptidase I (leader peptidase I) antikoerper, signal-induced proliferation associated gene 1 antikoerper, SIPA1 antikoerper, sipA1 antikoerper, Sipa1 antikoerper
- Hintergrund
- The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases.
- Molekulargewicht
- 112 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation
-