SIPA1 Antikörper (Middle Region)

Produktnummer ABIN634653

Der Kaninchen Polyklonal anti-SIPA1 Antikörper (ABIN634653) detektiert spezifisch SIPA1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SIPA1 Antikörper (Middle Region) (ABIN634653)

Target: SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIPA1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SIPA1 antibody was raised against the middle region of SIPA1

Aufreinigung: Affinity purified

Immunogen: SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIPA1 Blocking Peptide, (ABIN5616155), is also available for use as a blocking control in assays to test for specificity of this SIPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIPA1

Target: SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))

Andere Bezeichnung: SIPA1

Hintergrund: The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases.

Molekulargewicht: 112 kDa (MW of target protein)

Pathways: Response to Water Deprivation