Laminin beta 3 Antikörper (Middle Region)

Produktnummer ABIN634648

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Laminin beta 3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Laminin beta 3 Antikörper (Middle Region) (ABIN634648)

Target: Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Laminin beta 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Laminin beta 3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Laminin Beta 3 antibody was raised against the middle region of LAMB3

Aufreinigung: Affinity purified

Immunogen: Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Laminin Beta 3 Blocking Peptide, (ABIN938082), is also available for use as a blocking control in assays to test for specificity of this Laminin Beta 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Laminin beta 3

Target: Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))

Andere Bezeichnung: Laminin beta 3

Hintergrund: The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5.

Molekulargewicht: 128 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation