Osteomodulin Antikörper (Middle Region)

Produktnummer ABIN634647

Produktdetails anti-Osteomodulin Antikörper

Target: Osteomodulin (OMD)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Osteomodulin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Osteomodulin antibody was raised against the middle region of OMD

Aufreinigung: Affinity purified

Immunogen: Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Osteomodulin Blocking Peptide, catalog no. 33R-5180, is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Osteomodulin

Target: Osteomodulin (OMD)

Andere Bezeichnung: Osteomodulin (OMD Produkte)

Synonyme: si:ch211-103f16.5 antikoerper, OMD antikoerper, OSAD antikoerper, SLRR2C antikoerper, osteomodulin antikoerper, omd antikoerper, OMD antikoerper, Omd antikoerper

Hintergrund: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process