Periostin Antikörper (Middle Region)

Produktnummer ABIN634643

Der Kaninchen Polyklonal anti-Periostin Antikörper wird verwendet zum Nachweis von Periostin in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für Periostin Antikörper (Middle Region) (ABIN634643)

Target: Periostin (POSTN)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Periostin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Periostin Antikörper

Bindungsspezifität: Middle Region

Spezifität: POSTN antibody was raised against the middle region of POSTN

Aufreinigung: Affinity purified

Immunogen: POSTN antibody was raised using the middle region of POSTN corresponding to a region with amino acids VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POSTN Blocking Peptide, (ABIN5615476), is also available for use as a blocking control in assays to test for specificity of this POSTN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POSTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Periostin

Target: Periostin (POSTN)

Andere Bezeichnung: POSTN

Hintergrund: POSTN binds to heparin. It induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

Molekulargewicht: 93 kDa (MW of target protein)