MFAP4 Antikörper (N-Term)

Produktnummer ABIN634642

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MFAP4 in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für MFAP4 Antikörper (N-Term) (ABIN634642)

Target: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFAP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MFAP4 Antikörper

Bindungsspezifität: N-Term

Spezifität: MFAP4 antibody was raised against the N terminal of MFAP4

Aufreinigung: Affinity purified

Immunogen: MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFAP4 Blocking Peptide, (ABIN5614737), is also available for use as a blocking control in assays to test for specificity of this MFAP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFAP4

Target: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Andere Bezeichnung: MFAP4

Hintergrund: MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.

Molekulargewicht: 29 kDa (MW of target protein)