SIGLEC6 Antikörper (N-Term)

Produktnummer ABIN634640

Produktdetails anti-SIGLEC6 Antikörper

Target: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIGLEC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SIGLEC6 antibody was raised against the N terminal of SIGLEC6

Aufreinigung: Affinity purified

Immunogen: SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIGLEC6 Blocking Peptide, catalog no. 33R-6326, is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIGLEC6

Target: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Andere Bezeichnung: SIGLEC6 (SIGLEC6 Produkte)

Synonyme: SIGLEC6 antikoerper, CD327 antikoerper, CD33L antikoerper, CD33L1 antikoerper, CD33L2 antikoerper, CDW327 antikoerper, OBBP1 antikoerper, sialic acid binding Ig like lectin 6 antikoerper, SIGLEC6 antikoerper

Hintergrund: SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Molekulargewicht: 36 kDa (MW of target protein)