Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

SIGLEC6 Antikörper (N-Term)

Der Kaninchen Polyklonal Anti-SIGLEC6-Antikörper wurde für WB validiert. Er ist geeignet, SIGLEC6 in Proben von Human zu detektieren.
Produktnummer ABIN634640

Kurzübersicht für SIGLEC6 Antikörper (N-Term) (ABIN634640)

Target

Alle SIGLEC6 Antikörper anzeigen
SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Reaktivität

  • 47
  • 9
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
Human

Wirt

  • 43
  • 3
  • 1
Kaninchen

Klonalität

  • 45
  • 2
Polyklonal

Konjugat

  • 27
  • 4
  • 3
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser SIGLEC6 Antikörper ist unkonjugiert

Applikation

  • 34
  • 24
  • 11
  • 3
  • 2
  • 2
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 8
    • 7
    • 6
    • 6
    • 5
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    SIGLEC6 antibody was raised against the N terminal of SIGLEC6

    Aufreinigung

    Affinity purified

    Immunogen

    SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    SIGLEC6 Blocking Peptide, (ABIN5616144), is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC6 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

    Andere Bezeichnung

    SIGLEC6

    Hintergrund

    SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

    Molekulargewicht

    36 kDa (MW of target protein)
Sie sind hier:
Chat with us!