HAPLN1 Antikörper (N-Term)

Produktnummer ABIN634638

Produktdetails anti-HAPLN1 Antikörper

Target: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAPLN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAPLN1 antibody was raised against the N terminal of HAPLN1

Aufreinigung: Affinity purified

Immunogen: HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAPLN1 Blocking Peptide, catalog no. 33R-2605, is also available for use as a blocking control in assays to test for specificity of this HAPLN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAPLN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAPLN1

Target: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Andere Bezeichnung: HAPLN1 (HAPLN1 Produkte)

Synonyme: crtl1 antikoerper, hapln1 antikoerper, wu:fc26f11 antikoerper, wu:fc37g04 antikoerper, wu:fc50e12 antikoerper, wu:fc55h01 antikoerper, CRTL1 antikoerper, LP antikoerper, BB099155 antikoerper, CLP antikoerper, Crtl1 antikoerper, Crtl1l antikoerper, LP-1 antikoerper, CTRL1 antikoerper, hyaluronan and proteoglycan link protein 1 antikoerper, hyaluronan and proteoglycan link protein 1a antikoerper, HAPLN1 antikoerper, hapln1a antikoerper, Hapln1 antikoerper

Hintergrund: HAPLN1 stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Molekulargewicht: 40 kDa (MW of target protein)