HAPLN1 Antikörper (N-Term)

Produktnummer ABIN634638

Dieses Anti-HAPLN1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HAPLN1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für HAPLN1 Antikörper (N-Term) (ABIN634638)

Target: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAPLN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HAPLN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: HAPLN1 antibody was raised against the N terminal of HAPLN1

Aufreinigung: Affinity purified

Immunogen: HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAPLN1 Blocking Peptide, (ABIN937991), is also available for use as a blocking control in assays to test for specificity of this HAPLN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAPLN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAPLN1

Target: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Andere Bezeichnung: HAPLN1

Hintergrund: HAPLN1 stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Molekulargewicht: 40 kDa (MW of target protein)