-
- Target Alle NID2 Antikörper anzeigen
- NID2 (Nidogen 2 (NID2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NID2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV
- Top Product
- Discover our top product NID2 Primärantikörper
-
anti-Nidogen 2 (NID2) (AA 31-289) antibody
NID2 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Nidogen 2 (NID2) (AA 1276-1375) antibodyNID2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4G8 unconjugated
anti-Nidogen 2 (NID2) (AA 501-600) antibodyNID2 Reaktivität: Human ELISA, IF (cc), IF (p), ICC, IHC (fro), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Nidogen 2 (NID2) antibodyNID2 Reaktivität: Human, Maus, Ratte IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Nidogen 2 (NID2) (AA 1-969) antibodyNID2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Nidogen 2 (NID2) antibodyNID2 Reaktivität: Maus WB, IHC, ELISA, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Nidogen 2 (NID2) (AA 1044-1093) antibodyNID2 Reaktivität: Human, Ratte, Rind (Kuh), Meerschweinchen, Kaninchen, Fledermaus, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NID2 Blocking Peptide, catalog no. 33R-1881, is also available for use as a blocking control in assays to test for specificity of this NID2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NID2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NID2 (Nidogen 2 (NID2))
- Andere Bezeichnung
- NID2 (NID2 Produkte)
- Synonyme
- AW547149 antikoerper, Ly111 antikoerper, NID-2 antikoerper, entactin-2 antikoerper, nidogen-2 antikoerper, nidogen 2 antikoerper, Nid2 antikoerper, NID2 antikoerper
- Hintergrund
- Basement membranes, which are composed of type IV collagens, laminins, perlecan, and nidogen, are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.
- Molekulargewicht
- 148 kDa (MW of target protein)
-
Sie sind hier:
