NID2 Antikörper

Produktnummer ABIN634637

Der Kaninchen-Polyklonal Anti-NID2-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von NID2 in Proben aus Human. }

Kurzübersicht für NID2 Antikörper (ABIN634637)

Target: NID2 (Nidogen 2 (NID2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NID2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NID2 Antikörper

Aufreinigung: Affinity purified

Immunogen: NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NID2 Blocking Peptide, (ABIN937267), is also available for use as a blocking control in assays to test for specificity of this NID2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NID2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NID2

Target: NID2 (Nidogen 2 (NID2))

Andere Bezeichnung: NID2

Hintergrund: Basement membranes, which are composed of type IV collagens, laminins, perlecan, and nidogen, are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.

Molekulargewicht: 148 kDa (MW of target protein)