ADAMDEC1 Antikörper (Middle Region)

Produktnummer ABIN634635

Der Kaninchen Polyklonal anti-ADAMDEC1 Antikörper (ABIN634635) detektiert spezifisch ADAMDEC1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ADAMDEC1 Antikörper (Middle Region) (ABIN634635)

Target: ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAMDEC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADAMDEC1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ADAMDEC1 antibody was raised against the middle region of ADAMDEC1

Aufreinigung: Affinity purified

Immunogen: ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAMDEC1 Blocking Peptide, (ABIN938822), is also available for use as a blocking control in assays to test for specificity of this ADAMDEC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMDEC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAMDEC1

Target: ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))

Andere Bezeichnung: ADAMDEC1

Hintergrund: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation.

Molekulargewicht: 53 kDa (MW of target protein)