ADAMDEC1 Antikörper (Middle Region)
-
- Target Alle ADAMDEC1 Antikörper anzeigen
- ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAMDEC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADAMDEC1 antibody was raised against the middle region of ADAMDEC1
- Aufreinigung
- Affinity purified
- Immunogen
- ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
- Top Product
- Discover our top product ADAMDEC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAMDEC1 Blocking Peptide, catalog no. 33R-3436, is also available for use as a blocking control in assays to test for specificity of this ADAMDEC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMDEC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))
- Andere Bezeichnung
- ADAMDEC1 (ADAMDEC1 Produkte)
- Synonyme
- ADAMDEC1 antikoerper, 2210414L24Rik antikoerper, AI574231 antikoerper, Dcsn antikoerper, M12.219 antikoerper, ADAM-like, decysin 1 antikoerper, ADAM like decysin 1 antikoerper, Adamdec1 antikoerper, ADAMDEC1 antikoerper
- Hintergrund
- This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation.
- Molekulargewicht
- 53 kDa (MW of target protein)
-