SLIT3 Antikörper

Produktnummer ABIN634630

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLIT3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLIT3 Antikörper (ABIN634630)

Target: SLIT3 (Slit Homolog 3 (SLIT3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLIT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLIT3 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLIT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLIT3 Blocking Peptide, (ABIN5616289), is also available for use as a blocking control in assays to test for specificity of this SLIT3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLIT3

Target: SLIT3 (Slit Homolog 3 (SLIT3))

Andere Bezeichnung: SLIT3

Hintergrund: SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Molekulargewicht: 168 kDa (MW of target protein)

Pathways: Regulation of Cell Size