MYBPH Antikörper (N-Term)

Produktnummer ABIN634622

Der Kaninchen Polyklonal Anti-MYBPH-Antikörper wurde für WB validiert. Er ist geeignet, MYBPH in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MYBPH Antikörper (N-Term) (ABIN634622)

Target: MYBPH (Myosin Binding Protein H (MYBPH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYBPH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MYBPH Antikörper

Bindungsspezifität: N-Term

Spezifität: MYBPH antibody was raised against the N terminal of MYBPH

Aufreinigung: Affinity purified

Immunogen: MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYBPH Blocking Peptide, (ABIN940299), is also available for use as a blocking control in assays to test for specificity of this MYBPH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYBPH

Target: MYBPH (Myosin Binding Protein H (MYBPH))

Andere Bezeichnung: MYBPH

Hintergrund: MYBPH binds to myosin, probably involved in interaction with thick myofilaments in the A-band.

Molekulargewicht: 52 kDa (MW of target protein)