ANXA8L2 Antikörper (Middle Region)
Kurzübersicht für ANXA8L2 Antikörper (Middle Region) (ABIN634617)
Target
Alle ANXA8L2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- Middle Region
-
Spezifität
- Annexin A8-Like 2 antibody was raised against the middle region of ANXA8 L2
-
Kreuzreaktivität
- Human, Ratte (Rattus)
-
Aufreinigung
- Affinity purified
-
Immunogen
- Annexin A8-Like 2 antibody was raised using the middle region of ANXA8 L2 corresponding to a region with amino acids VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
Annexin A8-Like 2 Blocking Peptide, (ABIN5612085), is also available for use as a blocking control in assays to test for specificity of this Annexin A8-Like 2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA0 2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))
-
Andere Bezeichnung
- Annexin A8-Like 2
-
Substanzklasse
- Chemical
-
Hintergrund
- ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
-
Molekulargewicht
- 37 kDa (MW of target protein)
Target
-