Ig Antikörper

Produktnummer ABIN634611

Produktdetails anti-Ig Antikörper

Target: Ig

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ig Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ARHGDIG antibody was raised using a synthetic peptide corresponding to a region with amino acids DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGDIG Blocking Peptide, catalog no. 33R-1892, is also available for use as a blocking control in assays to test for specificity of this ARHGDIG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGDIG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ig

Target: Ig

Abstract: Ig Produkte

Synonyme: ATPIG antikoerper, ATPIQ antikoerper, A330005H02Rik antikoerper, AI315324 antikoerper, Ig antikoerper, ATPase phospholipid transporting 11C antikoerper, ATPase, class VI, type 11C antikoerper, ATP11C antikoerper, Atp11c antikoerper

Hintergrund: ARHGDIG is highly expressed in the entire brain, with regional variations. The mRNA is also present at high levels in kidney and pancreas and at moderate levels in spinal cord, stomach, and pituitary gland. ARHGDIG is mapped to chromosome band 16p13.3 which is rich in deletion mutants of genes involved in several human diseases, notably polycystic kidney disease, alpha-thalassemia, tuberous sclerosis, mental retardation, and cancer.

Molekulargewicht: 25 kDa (MW of target protein)