Annexin a10 Antikörper (Middle Region)

Produktnummer ABIN634610

Produktdetails anti-Annexin a10 Antikörper

Target: Annexin a10 (ANXA10) (Annexin A10 (ANXA10))

Bindungsspezifität: Middle Region

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin a10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Annexin A10 antibody was raised against the middle region of ANXA10

Kreuzreaktivität: Human

Aufreinigung: Affinity purified

Immunogen: Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A10 Blocking Peptide, catalog no. 33R-9693, is also available for use as a blocking control in assays to test for specificity of this Annexin A10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin a10

Target: Annexin a10 (ANXA10) (Annexin A10 (ANXA10))

Andere Bezeichnung: Annexin A10 (ANXA10 Produkte)

Synonyme: ANXA10 antikoerper, ANX14 antikoerper, RGD1560956 antikoerper, annexin A10 antikoerper, ANXA10 antikoerper, anxa10 antikoerper, Anxa10 antikoerper

Substanzklasse: Chemical

Hintergrund: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been dete

Molekulargewicht: 37 kDa (MW of target protein)