Annexin a10 Antikörper (Middle Region)
Kurzübersicht für Annexin a10 Antikörper (Middle Region) (ABIN634610)
Target
Alle Annexin a10 (ANXA10) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- Middle Region
-
Spezifität
- Annexin A10 antibody was raised against the middle region of ANXA10
-
Kreuzreaktivität
- Human
-
Aufreinigung
- Affinity purified
-
Immunogen
- Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
Annexin A10 Blocking Peptide, (ABIN5612076), is also available for use as a blocking control in assays to test for specificity of this Annexin A10 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA10 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Annexin a10 (ANXA10) (Annexin A10 (ANXA10))
-
Andere Bezeichnung
- Annexin A10
-
Substanzklasse
- Chemical
-
Hintergrund
- This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been dete
-
Molekulargewicht
- 37 kDa (MW of target protein)
Target
-