NPHP1 Antikörper

Produktnummer ABIN634609

Produktdetails anti-NPHP1 Antikörper

Target: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NPHP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NPHP1 Blocking Peptide, catalog no. 33R-3334, is also available for use as a blocking control in assays to test for specificity of this NPHP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPHP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NPHP1

Target: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Andere Bezeichnung: NPHP1 (NPHP1 Produkte)

Synonyme: JBTS4 antikoerper, NPH1 antikoerper, SLSN1 antikoerper, nephrocystin-1 antikoerper, NPHP1 antikoerper, im:7162391 antikoerper, wu:fi59g07 antikoerper, zgc:152930 antikoerper, Nphp1 antikoerper, nephrocystin 1 antikoerper, nephronophthisis 1 (juvenile) homolog (human) antikoerper, nephronophthisis 1 (juvenile) L homeolog antikoerper, nephronophthisis 1 antikoerper, nephrocystin-1 antikoerper, NPHP1 antikoerper, Nphp1 antikoerper, nphp1.L antikoerper, nphp1 antikoerper, LOC100725987 antikoerper

Hintergrund: Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.

Molekulargewicht: 83 kDa (MW of target protein)