NPHP1 Antikörper

Produktnummer ABIN634609

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch NPHP1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für NPHP1 Antikörper (ABIN634609)

Target: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NPHP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NPHP1 Antikörper

Aufreinigung: Affinity purified

Immunogen: NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NPHP1 Blocking Peptide, (ABIN938720), is also available for use as a blocking control in assays to test for specificity of this NPHP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPHP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NPHP1

Target: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Andere Bezeichnung: NPHP1

Hintergrund: Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.

Molekulargewicht: 83 kDa (MW of target protein)