Claudin 16 Antikörper (C-Term)

Produktnummer ABIN634606

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Claudin 16 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Claudin 16 Antikörper (C-Term) (ABIN634606)

Target: Claudin 16 (CLDN16)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Claudin 16 Antikörper

Bindungsspezifität: C-Term

Spezifität: Claudin 16 antibody was raised against the C terminal of CLDN16

Aufreinigung: Affinity purified

Immunogen: Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 16

Target: Claudin 16 (CLDN16)

Andere Bezeichnung: Claudin 16

Hintergrund: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Hepatitis C