ARMC3 Antikörper (Middle Region)
-
- Target Alle ARMC3 Antikörper anzeigen
- ARMC3 (Armadillo Repeat Containing 3 (ARMC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARMC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARMC3 antibody was raised against the middle region of ARMC3
- Aufreinigung
- Affinity purified
- Immunogen
- ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
- Top Product
- Discover our top product ARMC3 Primärantikörper
-
anti-Armadillo Repeat Containing 3 (ARMC3) (AA 752-840) antibody
ARMC3 Reaktivität: Human, Maus IF (cc), IF (p), ELISA, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Armadillo Repeat Containing 3 (ARMC3) (AA 647-696) antibodyARMC3 Reaktivität: Human, Maus, Schwein, Hund, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Armadillo Repeat Containing 3 (ARMC3) (AA 318-547) antibodyARMC3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARMC3 Blocking Peptide, catalog no. 33R-10121, is also available for use as a blocking control in assays to test for specificity of this ARMC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARMC3 (Armadillo Repeat Containing 3 (ARMC3))
- Andere Bezeichnung
- ARMC3 (ARMC3 Produkte)
- Synonyme
- 4921513G22Rik antikoerper, MGC76186 antikoerper, CT81 antikoerper, KU-CT-1 antikoerper, armadillo repeat containing 3 antikoerper, putative armc3 antikoerper, Armc3 antikoerper, armc3 antikoerper, ARMC3 antikoerper, Smp_105950 antikoerper
- Hintergrund
- Armadillo/beta-catenin like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis.
- Molekulargewicht
- 96 kDa (MW of target protein)
-
