ARMC3 Antikörper (Middle Region)

Produktnummer ABIN634605

Dieses Anti-ARMC3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ARMC3 in WB. Geeignet für Human.

Kurzübersicht für ARMC3 Antikörper (Middle Region) (ABIN634605)

Target: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARMC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ARMC3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARMC3 antibody was raised against the middle region of ARMC3

Aufreinigung: Affinity purified

Immunogen: ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARMC3 Blocking Peptide, (ABIN936085), is also available for use as a blocking control in assays to test for specificity of this ARMC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARMC3

Target: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Andere Bezeichnung: ARMC3

Hintergrund: Armadillo/beta-catenin like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis.

Molekulargewicht: 96 kDa (MW of target protein)