Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Symplekin Antikörper (N-Term)

Dieses Anti-Symplekin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Symplekin in WB. Geeignet für Human.
Produktnummer ABIN634602

Kurzübersicht für Symplekin Antikörper (N-Term) (ABIN634602)

Target

Alle Symplekin (SYMPK) Antikörper anzeigen
Symplekin (SYMPK)

Reaktivität

  • 25
  • 7
  • 6
  • 4
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
Human

Wirt

  • 21
  • 4
Kaninchen

Klonalität

  • 22
  • 3
Polyklonal

Konjugat

  • 25
Dieser Symplekin Antikörper ist unkonjugiert

Applikation

  • 22
  • 12
  • 7
  • 7
  • 6
  • 2
  • 2
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    Symplekin antibody was raised against the N terminal of SYMPK

    Aufreinigung

    Affinity purified

    Immunogen

    Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    Symplekin Blocking Peptide, (ABIN5616468), is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    Symplekin (SYMPK)

    Andere Bezeichnung

    Symplekin

    Hintergrund

    SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.

    Molekulargewicht

    141 kDa (MW of target protein)
Sie sind hier:
Chat with us!