ELMOD2 Antikörper (N-Term)

Produktnummer ABIN634597

Produktdetails anti-ELMOD2 Antikörper

Target: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ELMOD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ELMOD2 antibody was raised against the N terminal of ELMOD2

Aufreinigung: Affinity purified

Immunogen: ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ELMOD2 Blocking Peptide, catalog no. 33R-2873, is also available for use as a blocking control in assays to test for specificity of this ELMOD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMOD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ELMOD2

Target: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Andere Bezeichnung: ELMOD2 (ELMOD2 Produkte)

Synonyme: ELMOD2 antikoerper, 9830169G11Rik antikoerper, ELMO domain containing 2 antikoerper, ELMO/CED-12 domain containing 2 antikoerper, ELMOD2 antikoerper, Elmod2 antikoerper

Hintergrund: ELMOD2 is an engulfment and motility (ELMO) domain-containing protein.

Molekulargewicht: 35 kDa (MW of target protein)