PPP1R13B Antikörper

Produktnummer ABIN634596

Produktdetails anti-PPP1R13B Antikörper

Target: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R13B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1R13B Blocking Peptide, catalog no. 33R-2400, is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R13B

Target: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Andere Bezeichnung: PPP1R13B (PPP1R13B Produkte)

Synonyme: ASPP1 antikoerper, p53BP2-like antikoerper, p85 antikoerper, AI449786 antikoerper, AW545810 antikoerper, Tp53bp2 antikoerper, Trp53bp2 antikoerper, protein phosphatase 1 regulatory subunit 13B antikoerper, protein phosphatase 1, regulatory subunit 13B antikoerper, protein phosphatase 1 regulatory subunit 13B L homeolog antikoerper, protein phosphatase 1, regulatory subunit 13Bb antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 13B antikoerper, PPP1R13B antikoerper, Ppp1r13b antikoerper, ppp1r13b.L antikoerper, ppp1r13bb antikoerper, ppp1r13b antikoerper

Hintergrund: PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.

Molekulargewicht: 119 kDa (MW of target protein)

Pathways: p53 Signalweg