BAG3 Antikörper (Middle Region)
-
- Target Alle BAG3 Antikörper anzeigen
- BAG3 (BCL2-Associated Athanogene 3 (BAG3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BAG3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BAG3 antibody was raised against the middle region of BAG3
- Aufreinigung
- Affinity purified
- Immunogen
- BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
- Top Product
- Discover our top product BAG3 Primärantikörper
-
anti-BCL2-Associated Athanogene 3 (BAG3) antibody
BAG3 Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) (C-Term) antibodyVerified BAG3 Reaktivität: Human WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) (AA 380-575) antibodyBAG3 Reaktivität: Human WB, IHC, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) (C-Term) antibodyBAG3 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) antibodyBAG3 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) (C-Term) antibodyBAG3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) (AA 220-420) antibodyBAG3 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) antibodyBAG3 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Monoclonal 3D8 unconjugated Recombinant Antibody
anti-BCL2-Associated Athanogene 3 (BAG3) (AA 1-575) antibodyBAG3 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-BCL2-Associated Athanogene 3 (BAG3) (AA 1-575) antibodyBAG3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5A8 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BAG3 Blocking Peptide, catalog no. 33R-6927, is also available for use as a blocking control in assays to test for specificity of this BAG3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAG3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BAG3 (BCL2-Associated Athanogene 3 (BAG3))
- Andere Bezeichnung
- BAG3 (BAG3 Produkte)
- Synonyme
- bag3-A antikoerper, MGC53113 antikoerper, zgc:100859 antikoerper, BAG3 antikoerper, ATBAG3 antikoerper, BCL-2-associated athanogene 3 antikoerper, T28J14.160 antikoerper, T28J14_160 antikoerper, BAG-3 antikoerper, BIS antikoerper, CAIR-1 antikoerper, MFM6 antikoerper, AA407278 antikoerper, Bis antikoerper, mg638 antikoerper, BCL2 associated athanogene 3 L homeolog antikoerper, BCL2-associated athanogene 3 antikoerper, BCL2 associated athanogene 3 antikoerper, BCL-2-associated athanogene 3 antikoerper, Bcl2-associated athanogene 3 antikoerper, bag3.L antikoerper, bag3 antikoerper, BAG3 antikoerper, Bag3 antikoerper
- Hintergrund
- BAG3 inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. BAG3 has anti-apoptotic activity.
- Molekulargewicht
- 61 kDa (MW of target protein)
-
