ELMO3 Antikörper (Middle Region)

Produktnummer ABIN634591

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ELMO3 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für ELMO3 Antikörper (Middle Region) (ABIN634591)

Target: ELMO3 (Engulfment and Cell Motility 3 (ELMO3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ELMO3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ELMO3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ELMO3 antibody was raised against the middle region of ELMO3

Aufreinigung: Affinity purified

Immunogen: ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ELMO3 Blocking Peptide, (ABIN5613360), is also available for use as a blocking control in assays to test for specificity of this ELMO3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMO3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ELMO3

Target: ELMO3 (Engulfment and Cell Motility 3 (ELMO3))

Andere Bezeichnung: ELMO3

Hintergrund: ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.

Molekulargewicht: 87 kDa (MW of target protein)