TSH receptor Antikörper (N-Term)

Produktnummer ABIN634577

Der Kaninchen Polyklonal Anti-TSH receptor-Antikörper wurde für WB validiert. Er ist geeignet, TSH receptor in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für TSH receptor Antikörper (N-Term) (ABIN634577)

Target: TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSH receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSH receptor Antikörper

Bindungsspezifität: N-Term

Spezifität: TSHR antibody was raised against the N terminal of TSHR

Aufreinigung: Affinity purified

Immunogen: TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids ELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSHR Blocking Peptide, (ABIN937935), is also available for use as a blocking control in assays to test for specificity of this TSHR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSHR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSH receptor

Target: TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))

Andere Bezeichnung: TSHR

Hintergrund: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).

Molekulargewicht: 84 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis