IL-22 Antikörper (C-Term)

Produktnummer ABIN634575

Dieses Anti-IL-22-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IL-22 in WB. Geeignet für Human und Maus.

Kurzübersicht für IL-22 Antikörper (C-Term) (ABIN634575)

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL-22 Antikörper

Bindungsspezifität: C-Term

Spezifität: IL22 antibody was raised against the C terminal of IL22

Aufreinigung: Affinity purified

Immunogen: IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL22 Blocking Peptide, (ABIN937095), is also available for use as a blocking control in assays to test for specificity of this IL22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-22

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Andere Bezeichnung: IL22

Hintergrund: IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.

Molekulargewicht: 20 kDa (MW of target protein)