MUL1 Antikörper (Middle Region)
-
- Target Alle MUL1 Antikörper anzeigen
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MUL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF166 antibody was raised against the middle region of C1 rf166
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
- Top Product
- Discover our top product MUL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF166 Blocking Peptide, catalog no. 33R-3439, is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
- Andere Bezeichnung
- C1ORF166 (MUL1 Produkte)
- Synonyme
- C1orf166 antikoerper, GIDE antikoerper, MAPL antikoerper, MULAN antikoerper, RNF218 antikoerper, RP11-401M16.2 antikoerper, mul1 antikoerper, zgc:92166 antikoerper, 0610009K11Rik antikoerper, AV000801 antikoerper, Gide antikoerper, RGD1309944 antikoerper, im:7146383 antikoerper, zgc:165594 antikoerper, mitochondrial E3 ubiquitin protein ligase 1 antikoerper, mitochondrial E3 ubiquitin protein ligase 1 L homeolog antikoerper, mitochondrial E3 ubiquitin protein ligase 1a antikoerper, mitochondrial ubiquitin ligase activator of NFKB 1 antikoerper, mitochondrial E3 ubiquitin protein ligase 1b antikoerper, MUL1 antikoerper, mul1.L antikoerper, mul1a antikoerper, Mul1 antikoerper, mul1b antikoerper
- Hintergrund
- C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-