DGKE Antikörper (N-Term)

Produktnummer ABIN634569

Produktdetails anti-DGKE Antikörper

Target: DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGKE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DGKE antibody was raised against the N terminal of DGKE

Aufreinigung: Affinity purified

Immunogen: DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGKE Blocking Peptide, catalog no. 33R-2256, is also available for use as a blocking control in assays to test for specificity of this DGKE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DGKE

Target: DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))

Andere Bezeichnung: DGKE (DGKE Produkte)

Synonyme: MGC81643 antikoerper, DGKE antikoerper, C87606 antikoerper, DAGK6 antikoerper, DGK antikoerper, DAGK5 antikoerper, NPHS7 antikoerper, diacylglycerol kinase epsilon S homeolog antikoerper, diacylglycerol kinase epsilon antikoerper, diacylglycerol kinase, epsilon antikoerper, dgke.S antikoerper, DGKE antikoerper, dgke antikoerper, LOC5575244 antikoerper, Dgke antikoerper

Hintergrund: Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.

Molekulargewicht: 64 kDa (MW of target protein)