ASB5 Antikörper (C-Term)

Produktnummer ABIN634568

Der Kaninchen Polyklonal Anti-ASB5-Antikörper wurde für WB validiert. Er ist geeignet, ASB5 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für ASB5 Antikörper (C-Term) (ABIN634568)

Target: ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASB5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASB5 Antikörper

Bindungsspezifität: C-Term

Spezifität: ASB5 antibody was raised against the C terminal of ASB5

Aufreinigung: Affinity purified

Immunogen: ASB5 antibody was raised using the C terminal of ASB5 corresponding to a region with amino acids LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASB5 Blocking Peptide, (ABIN940543), is also available for use as a blocking control in assays to test for specificity of this ASB5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASB5

Target: ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))

Andere Bezeichnung: ASB5

Hintergrund: They contain ankyrin repeat sequence and SOCS box domain. The SOCSbox serves to couple suppressor of cytokine signalling (SOCS)proteins and their binding partners with the elongin B and Ccomplex, possibly targeting them for degradation.

Molekulargewicht: 36 kDa (MW of target protein)