Heme Oxygenase Antikörper

Produktnummer ABIN634566

Produktdetails anti-Heme Oxygenase Antikörper

Target: Heme Oxygenase (HMOX)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Heme Oxygenase antibody was raised using a synthetic peptide corresponding to a region with amino acids ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Heme Oxygenase Blocking Peptide, catalog no. 33R-2708, is also available for use as a blocking control in assays to test for specificity of this Heme Oxygenase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMOX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Heme Oxygenase

Target: Heme Oxygenase (HMOX)

Andere Bezeichnung: Heme Oxygenase (HMOX Produkte)

Hintergrund: HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter.

Molekulargewicht: 33 kDa (MW of target protein)