SHISA5 Antikörper (Middle Region)

Produktnummer ABIN634555

Produktdetails anti-SHISA5 Antikörper

Target: SHISA5 (Shisa Homolog 5 (SHISA5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHISA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SCOTIN antibody was raised against the middle region of Scotin

Aufreinigung: Affinity purified

Immunogen: SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCOTIN Blocking Peptide, catalog no. 33R-1648, is also available for use as a blocking control in assays to test for specificity of this SCOTIN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCOTIN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHISA5

Target: SHISA5 (Shisa Homolog 5 (SHISA5))

Andere Bezeichnung: SCOTIN (SHISA5 Produkte)

Synonyme: SCOTIN antikoerper, 2310008D10Rik antikoerper, 6430628I05Rik antikoerper, Scotin antikoerper, mShisa5 antikoerper, shisa family member 5 antikoerper, SHISA5 antikoerper, Shisa5 antikoerper

Hintergrund: This protein can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis.

Molekulargewicht: 25 kDa (MW of target protein)