ULBP1 Antikörper (N-Term)

Produktnummer ABIN634554

Dieses Anti-ULBP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ULBP1 in WB. Geeignet für Human.

Kurzübersicht für ULBP1 Antikörper (N-Term) (ABIN634554)

Target: ULBP1 (UL16 Binding Protein 1 (ULBP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ULBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ULBP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ULBP1 antibody was raised against the N terminal of ULBP1

Aufreinigung: Affinity purified

Immunogen: ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ULBP1 Blocking Peptide, (ABIN5616905), is also available for use as a blocking control in assays to test for specificity of this ULBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ULBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ULBP1

Target: ULBP1 (UL16 Binding Protein 1 (ULBP1))

Andere Bezeichnung: ULBP1

Hintergrund: ULBP1 is the ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process