ADAM33 Antikörper (Middle Region)

Produktnummer ABIN634549

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ADAM33 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ADAM33 Antikörper (Middle Region) (ABIN634549)

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADAM33 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ADAM33 antibody was raised against the middle region of ADAM33

Aufreinigung: Affinity purified

Immunogen: ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM33 Blocking Peptide, (ABIN939097), is also available for use as a blocking control in assays to test for specificity of this ADAM33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM33

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Andere Bezeichnung: ADAM33

Hintergrund: ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.

Molekulargewicht: 62 kDa (MW of target protein)