UQCRFS1 Antikörper (N-Term)

Produktnummer ABIN634545

Produktdetails anti-UQCRFS1 Antikörper

Target: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UQCRFS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UQCRFS1 antibody was raised against the N terminal of UQCRFS1

Aufreinigung: Affinity purified

Immunogen: UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UQCRFS1 Blocking Peptide, catalog no. 33R-6220, is also available for use as a blocking control in assays to test for specificity of this UQCRFS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UQCRFS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UQCRFS1

Target: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Andere Bezeichnung: UQCRFS1 (UQCRFS1 Produkte)

Synonyme: uqcrfs1 antikoerper, MGC53134 antikoerper, rip1 antikoerper, ris1 antikoerper, risp antikoerper, uqcr5 antikoerper, fb78f10 antikoerper, wu:fb05d11 antikoerper, wu:fb78f10 antikoerper, wu:fj05e12 antikoerper, zgc:73109 antikoerper, zgc:85614 antikoerper, GLEAN_00043 antikoerper, RIP1 antikoerper, RIS1 antikoerper, RISP antikoerper, UQCR5 antikoerper, 4430402G14Rik antikoerper, AI875505 antikoerper, LRRGT00195 antikoerper, UQCRFSL1 antikoerper, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 S homeolog antikoerper, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 antikoerper, cytochrome b-c1 complex subunit Rieske, mitochondrial antikoerper, iron-sulfur protein 1 antikoerper, uqcrfs1.S antikoerper, uqcrfs1 antikoerper, LOC661125 antikoerper, LOC705178 antikoerper, UQCRFS1 antikoerper, Uqcrfs1 antikoerper, LOC100227575 antikoerper, isp1 antikoerper

Hintergrund: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Proton Transport