ADCY10 Antikörper (N-Term)

Produktnummer ABIN634544

Produktdetails anti-ADCY10 Antikörper

Target: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADCY10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SAC antibody was raised against the N terminal Of Sac

Aufreinigung: Affinity purified

Immunogen: SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAC Blocking Peptide, catalog no. 33R-9558, is also available for use as a blocking control in assays to test for specificity of this SAC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADCY10

Target: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Andere Bezeichnung: SAC (ADCY10 Produkte)

Synonyme: HCA2 antikoerper, RP1-313L4.2 antikoerper, SAC antikoerper, SACI antikoerper, Sacy antikoerper, Sac antikoerper, 4930431D04Rik antikoerper, 4931412F17 antikoerper, sAC antikoerper, ADCY10 antikoerper, SACY antikoerper, adenylate cyclase 10 antikoerper, adenylate cyclase 10 (soluble) antikoerper, ADCY10 antikoerper, Adcy10 antikoerper

Hintergrund: SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.

Molekulargewicht: 187 kDa (MW of target protein)

Pathways: cAMP Metabolic Process