ADCY10 Antikörper (N-Term)

Produktnummer ABIN634544

Der Kaninchen Polyklonal Anti-ADCY10-Antikörper wurde für WB validiert. Er ist geeignet, ADCY10 in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für ADCY10 Antikörper (N-Term) (ABIN634544)

Target: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADCY10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADCY10 Antikörper

Bindungsspezifität: N-Term

Spezifität: SAC antibody was raised against the N terminal Of Sac

Aufreinigung: Affinity purified

Immunogen: SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAC Blocking Peptide, (ABIN5615992), is also available for use as a blocking control in assays to test for specificity of this SAC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADCY10

Target: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Andere Bezeichnung: SAC

Hintergrund: SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.

Molekulargewicht: 187 kDa (MW of target protein)

Pathways: cAMP Metabolic Process