ADCY8 Antikörper

Produktnummer ABIN634530

Dieses Anti-ADCY8-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ADCY8 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ADCY8 Antikörper (ABIN634530)

Target: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADCY8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADCY8 Antikörper

Aufreinigung: Affinity purified

Immunogen: ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADCY8 Blocking Peptide, (ABIN937880), is also available for use as a blocking control in assays to test for specificity of this ADCY8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADCY8

Target: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Andere Bezeichnung: ADCY8

Hintergrund: Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase.

Molekulargewicht: 140 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma