NMBR Antikörper (N-Term)

Produktnummer ABIN634529

Produktdetails anti-NMBR Antikörper

Target: NMBR (Neuromedin B Receptor (NMBR))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NMBR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NMBR antibody was raised against the N terminal of NMBR

Aufreinigung: Affinity purified

Immunogen: NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NMBR Blocking Peptide, catalog no. 33R-7356, is also available for use as a blocking control in assays to test for specificity of this NMBR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMBR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NMBR

Target: NMBR (Neuromedin B Receptor (NMBR))

Andere Bezeichnung: NMBR (NMBR Produkte)

Synonyme: NMBR antikoerper, si:dkey-283f18.1 antikoerper, BB182387 antikoerper, NMB-R antikoerper, neuromedin B receptor antikoerper, NMBR antikoerper, nmbr antikoerper, Nmbr antikoerper

Hintergrund: Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.

Molekulargewicht: 43 kDa (MW of target protein)