ATL2 Antikörper (C-Term)

Produktnummer ABIN634521

Produktdetails anti-ATL2 Antikörper

Target: ATL2 (Atlastin GTPase 2 (ATL2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARL6 IP2 antibody was raised against the C terminal of ARL6 P2

Aufreinigung: Affinity purified

Immunogen: ARL6 IP2 antibody was raised using the C terminal of ARL6 P2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL6IP2 Blocking Peptide, catalog no. 33R-5950, is also available for use as a blocking control in assays to test for specificity of this ARL6IP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 P2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATL2

Target: ATL2 (Atlastin GTPase 2 (ATL2))

Andere Bezeichnung: ARL6IP2 (ATL2 Produkte)

Synonyme: ARL3IP2 antikoerper, ARL6IP2 antikoerper, atlastin2 antikoerper, 2010110I21Rik antikoerper, AA407293 antikoerper, AV334690 antikoerper, Aip-2 antikoerper, Arl6ip2 antikoerper, arl6ip2 antikoerper, ATL2 antikoerper, fc06e01 antikoerper, wu:fc06e01 antikoerper, wu:fv60d03 antikoerper, atlastin GTPase 2 antikoerper, atlastin GTPase 2 L homeolog antikoerper, ATL2 antikoerper, Atl2 antikoerper, atl2.L antikoerper, atl2 antikoerper

Hintergrund: ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.

Molekulargewicht: 66 kDa (MW of target protein)