ATL2 Antikörper (C-Term)

Produktnummer ABIN634521

Dieses Anti-ATL2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ATL2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ATL2 Antikörper (C-Term) (ABIN634521)

Target: ATL2 (Atlastin GTPase 2 (ATL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATL2 Antikörper

Bindungsspezifität: C-Term

Spezifität: ARL6 IP2 antibody was raised against the C terminal of ARL6 P2

Aufreinigung: Affinity purified

Immunogen: ARL6 IP2 antibody was raised using the C terminal of ARL6 P2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL6IP2 Blocking Peptide, (ABIN5612161), is also available for use as a blocking control in assays to test for specificity of this ARL6IP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 P2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATL2

Target: ATL2 (Atlastin GTPase 2 (ATL2))

Andere Bezeichnung: ARL6IP2

Hintergrund: ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.

Molekulargewicht: 66 kDa (MW of target protein)